Matthew’s Website
a face made for radio, a voice made for print

Mail from SEO Spammers
Self-Inflicted First World Problems

I hate getting email from SEO spammers, but it’s a self-inflicted First World problem. This is what I get for having a website in the first place. They’re just trying to make a living, after all. Nevertheless, I don’t feel obligated to refrain from playing with them a little. I’ll be documenting amusing or egregious examples here.

I’ll be posting raw text with most headers intact, though I’ll only include the plain text portions of HTML emails. If any of these spammers are foolish enough to include a postal address, I’ll be stripping that out too.

Table of Contents

Dhee DD <diya@lishawn.com>

Return-Path: <diya@lishawn.com>
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti43n16 (Cyrus 3.5.0-alpha0-1126-g6962059b07-fm-20210901.001-g6962059b) with LMTPA;
	 Thu, 02 Sep 2021 09:05:13 -0400
X-Cyrus-Session-Id: sloti43n16-1630587913-414413-2-4758527805104557224
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-sender-reputation: 500 (none)
X-Spam-score: 0.1
X-Spam-hits: DCC_REPUT_70_89 0.1, HTML_MESSAGE 0.001, ME_SENDERREP_NEUTRAL 0.001,
  RCVD_IN_DNSWL_NONE -0.0001, RCVD_IN_MSPIKE_H2 -0.001,
  SPF_HELO_NONE 0.001, SPF_PASS -0.001, LANGUAGES en, BAYES_USED none,
  SA_VERSION 3.4.2
X-Spam-source: IP='209.85.219.193', Host='mail-yb1-f193.google.com', Country='US',
  FromHeader='com', MailFrom='com'
X-Spam-charsets: plain='UTF-8', html='UTF-8'
X-Resolved-to: [REDACTED]
X-Delivered-to: [REDACTED]
X-Mail-from: diya@lishawn.com
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Thu, 02 Sep 2021 09:05:13 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 4DCA3C801E3
	for [REDACTED]; Thu,  2 Sep 2021 09:05:13 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 2C929027EE0;
    Thu, 2 Sep 2021 09:05:13 -0400
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm3; t=
    1630587913; b=PYyFoy6LWl9LNXENvRculbR+tJC2OAczp46Ny8eEZ/OUGLE8oj
    YO7kzBfHoBvihBw5xZ9kUZLpFCuDJGZ9exuTliGCz7uBOAWQI1cL/jmFcWIAkxcj
    0RNyr/KfQAL8nQHRA5uMSaBPufL+INvvD40LEuyXw4eDkNCQAt/EtzXdYevEUVMW
    NvSAJ3czaKr0lYTPzJbyPHSHKefNa2Ivt1a0R0dw8nMUVCF3hSa2zH+Dk9g/ckv9
    LXqBzFdYw3oGG0t/yCHm2BKxATlbjQbnVYPrKye2KwXDddIIfvurngvEDBc9Ix92
    IsgS8w8LaDC4XPTqOaelzf5lodzAyBZCzqOQ==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=mime-version:from:date:message-id:subject
    :to:content-type; s=fm3; t=1630587913; bh=6alHcHItYJ6twbr5WYOTIe
    T7GzbWsay7wf0rNYJwJZ0=; b=CW+uuo62s1cN1EmReSyOAMEH5i25/aXfLDrecT
    tAw43aj7HKukKp6NfKMgrjktKCgQXHWIRBWcsUDXzcQRyPZmTC4PSB45mM1dDOuD
    bb+o/HNMbTBnxFyMpYsxQLU582KURXvHiLZ3S1yTupggtDF8BVPIKMMi4SAcFoz2
    FGyAZSU3o5UjKiUTJYOgZY4xhCEhVCfUPl6TTi3qe5EfHJuUuAve6QSRwfELXJoV
    KE92G2FhftbkZX/GK/iPMHASJezCQ1yAJ/D1w4EC6Xu7Ja90h+9HRAAqKiSwQ5d7
    J/HprHxZwwdG0gJZpLe2lZaUedL640CKS0n9IsKrFJFrUqyQ==
ARC-Authentication-Results: i=1; mx6.messagingengine.com;
    arc=none (no signatures found);
    bimi=skipped (DMARC did not pass);
    dkim=pass (2048-bit rsa key sha256)
    header.d=lishawn-com.20150623.gappssmtp.com
    header.i=@lishawn-com.20150623.gappssmtp.com header.b=TfL7L6sP
    header.a=rsa-sha256 header.s=20150623 x-bits=2048;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=lishawn.com;
    iprev=pass smtp.remote-ip=209.85.219.193 (mail-yb1-f193.google.com);
    spf=pass smtp.mailfrom=diya@lishawn.com
    smtp.helo=mail-yb1-f193.google.com;
    x-aligned-from=pass (Address match);
    x-csa=none;
    x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
    header.i=@1e100.net header.b=Jd8qhfmV;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-yb1-f193.google.com
    policy.ptr=mail-yb1-f193.google.com;
    x-return-mx=pass header.domain=lishawn.com policy.is_org=yes
    (MX Records found: aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,alt3.aspmx.l.google.com,alt4.aspmx.l.google.com);
    x-return-mx=pass smtp.domain=lishawn.com policy.is_org=yes
    (MX Records found: alt4.aspmx.l.google.com,aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,alt3.aspmx.l.google.com);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=0 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=none (no signatures found);
    bimi=skipped (DMARC did not pass);
    dkim=pass (2048-bit rsa key sha256)
      header.d=lishawn-com.20150623.gappssmtp.com
      header.i=@lishawn-com.20150623.gappssmtp.com header.b=TfL7L6sP
      header.a=rsa-sha256 header.s=20150623 x-bits=2048;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=lishawn.com;
    iprev=pass smtp.remote-ip=209.85.219.193 (mail-yb1-f193.google.com);
    spf=pass smtp.mailfrom=diya@lishawn.com
      smtp.helo=mail-yb1-f193.google.com;
    x-aligned-from=pass (Address match);
    x-csa=none;
    x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
      header.i=@1e100.net header.b=Jd8qhfmV;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-yb1-f193.google.com
      policy.ptr=mail-yb1-f193.google.com;
    x-return-mx=pass header.domain=lishawn.com policy.is_org=yes
      (MX Records found: aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,alt3.aspmx.l.google.com,alt4.aspmx.l.google.com);
    x-return-mx=pass smtp.domain=lishawn.com policy.is_org=yes
      (MX Records found: alt4.aspmx.l.google.com,aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,alt3.aspmx.l.google.com);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=0 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddruddvhedgheelucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhfffkuf
    fvtgesrgdtreertddtjeenucfhrhhomhepffhhvggvucffffcuoeguihihrgeslhhishhh
    rgifnhdrtghomheqnecuggftrfgrthhtvghrnhepvdduheelffegveekhfehieekuedvhe
    dtgeffgffggeetffeltdehvdehhfeuleeinecukfhppedvtdelrdekhedrvdduledrudel
    feenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhe
    drvdduledrudelfedphhgvlhhopehmrghilhdqhigsuddqfhduleefrdhgohhoghhlvgdr
    tghomhdpmhgrihhlfhhrohhmpeeoughihigrsehlihhshhgrfihnrdgtohhmqe
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (lishawn.com: Sender is authorized to use 'diya@lishawn.com' in 'mfrom' identity (mechanism 'include:websitewelcome.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="diya@lishawn.com";
    helo=mail-yb1-f193.google.com;
    client-ip=209.85.219.193
Received: from mail-yb1-f193.google.com (mail-yb1-f193.google.com [209.85.219.193])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for [REDACTED]; Thu,  2 Sep 2021 09:05:11 -0400 (EDT)
Received: by mail-yb1-f193.google.com with SMTP id r4so3722380ybp.4
        for [REDACTED]; Thu, 02 Sep 2021 06:05:11 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=lishawn-com.20150623.gappssmtp.com; s=20150623;
        h=mime-version:from:date:message-id:subject:to;
        bh=6alHcHItYJ6twbr5WYOTIeT7GzbWsay7wf0rNYJwJZ0=;
        b=TfL7L6sPV99+B28456/p/mWOAyZE6oavilKdi+Zfptg5ghWOWQOmo13ABltOG0QGDH
         1A5W/k8af3lpu9PLtwHjQZutGeWYW6VfO6TM7kcnyRE4pN8prNsDxuPGnReToZrbEoC7
         L8cjpcIe6tF7mtIaGgLcjQclB/DPqMteUH3Xz1UGWInRDYTIlaezt7tXV0hfs1q2+iEU
         JAsemVotdJyxagvoqCznl5mN4xGsFThiFvIRqRJcDRyZVyRQMUgyIJ4IKuLTecoFRUlT
         DSWlqRQoDDuiZNe6thn68wmkMZoN93e/D+1eskC30aRNsHN3IpGwEJaKAfiZXy8uYuZX
         WDiQ==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:mime-version:from:date:message-id:subject:to;
        bh=6alHcHItYJ6twbr5WYOTIeT7GzbWsay7wf0rNYJwJZ0=;
        b=Jd8qhfmV6zFs6Ef0BjFcvOUIaLrIlIW0UogR5Ky0JpElL79QA+b/T8cLNQsSi6pqEB
         I37ElY4mcDTTUkSdPVmRW9dwZyxOLcjm3nIJJtHj6YcDei8KUR6SmFLLKGEp+mqMcCFQ
         767HfA2GxN1idx2OZDUvbIaQcmOm5uvR/WvxLW5K4sGBlRYVmP98ChgXB7vmsDXOEve1
         ZmQ33FZDKSQ935hue6hz5WKV3CCCjffqnkO90tKdSc4HJuUto0Eztv0MRMPM8rZ1H2aR
         M3crgzHp8lbaqs1gqBxdE+aDjbrxkp9PKqG+z9pImB546j6REIsWEgrY57qnjW7BUcuc
         PLEw==
X-Gm-Message-State: AOAM531HanfaTNO/A/gDfbu1J97qgusgg/HgZK4mjx+ofIud3Y0BfXkh
	j2m73UnmNi2dAcD0v+GoOPXnQKunCKhHe7ts2NW9FTdXSwyCHIwn
X-Google-Smtp-Source: ABdhPJyRo28uG/dEjJlJ30GDELEDzBgecqbGyJx5+/tNBJAdv4EIeaS2Ft5ydBxRUJb9oowsjFNn85jf43UzI3uirBI=
X-Received: by 2002:a25:3816:: with SMTP id f22mr4025736yba.54.1630587908706;
 Thu, 02 Sep 2021 06:05:08 -0700 (PDT)
MIME-Version: 1.0
Received: by 2002:a05:7010:4812:b029:107:42c4:8312 with HTTP; Thu, 2 Sep 2021
 06:05:08 -0700 (PDT)
From: Dhee DD <diya@lishawn.com>
Date: Thu, 2 Sep 2021 18:35:08 +0530
Message-ID: <CACz6Eb0NxamH4=B2z1Af-rGuwN0RWoG_A6YB57-07c5-Yq2Tpw@mail.gmail.com>
Subject: Matthewgraybosch shortlisted for 'Top Most Promising Health Websites
 For 2021'
To: [REDACTED]
Content-Type: multipart/alternative; boundary="0000000000001334e705cb02d56b"

--0000000000001334e705cb02d56b
Content-Type: text/plain; charset="UTF-8"

Hello!

This is Diya from Li Creative Technologies, We're very pleased to let
you know that 'Matthewgraybosch' has been shortlisted by our editorial
board which will be included and honored as "Top Most Promising Health
Sites For 2021".

This post with one page profile of selected blog owners will be
included to all our newsletter readers. It's a focus on Health Blog
writers, which will rank in google for all top Health keywords
shortly.

We feel that inclusion of 'Matthewgraybosch' in this honor list and a
small line about your website in the post can help 'Matthewgraybosch'
differentiate from its competitors.

I'd like to talk to the concerned person from your organization at the
earliest to finalize 'Matthewgraybosch' inclusion in this list.

It's a very unique promotion proposal; we hope 'Matthewgraybosch'
makes better use of it.

Waiting to know what you think on the same.

Regards,

Diya

If this Diya character is from “Li Creative Technologies”, why are they sending from “lishawn.com”? There’s nothing there but a default WordPress installation. However, a search for “Li Creative Technologies” turns up a couple of results.

licreative.com
“LCT (Li Creative Technologies, Inc.) is a recognized leader in 3D audio, 3D music, speech recognition, natural language processing, artificial intelligence, machine learning, and advanced digital signal processing. The company provides new products, design, services, and solutions for the US government and many commercial enterprises, including the smartphone, video conferencing, home automation, music, bank, and transportation industries.”
licreativetechnologies.com
“We are indeed Pondicherry’s SEO agency and one of Chennai’s top SEO companies. We do provide consulting and SEO services. Our procedure involves campaigns for Google Ads (pay per click), website creation, social networks and cleaning of reputations.”

I think the second result is the most likely source. What I don’t get is why my personal website is being mistaken for a health blog. Furthermore, why bother with a shortlist? If you want to add me to a list of “promising health bloggers for 2021”, just do it. There’s no need to consult me, but if you really want me to know you could have sent a link to the list after posting it.

The fact that they want to contact the “concerned person” to “finalize” inclusion in the list suggests that this is some kind of attempt at setting up a con. This kind of grift might fly in Pondicherry or Chennai, but I’m a New Yorker at heart and it’s gonna take a bit more effort to draw me into a scam.

Lauren Harris <lharris@slateberry.com>

Return-Path: <lharris@slateberry.com>
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti43n16 (Cyrus 3.5.0-alpha0-1118-g75eff666e5-fm-20210816.002-g75eff666) with LMTPA;
	 Wed, 18 Aug 2021 14:07:57 -0400
X-Cyrus-Session-Id: sloti43n16-1629310077-2570241-2-3470273511805307524
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-sender-reputation: 500 (none)
X-Spam-score: 0.0
X-Spam-hits: HTML_MESSAGE 0.001, ME_SENDERREP_NEUTRAL 0.001, RCVD_IN_DNSWL_NONE -0.0001,
  RCVD_IN_MSPIKE_H2 -0.001, SPF_HELO_NONE 0.001, SPF_PASS -0.001,
  T_KAM_HTML_FONT_INVALID 0.01, UNPARSEABLE_RELAY 0.001, LANGUAGES en,
  BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.166.43', Host='mail-io1-f43.google.com', Country='US',
  FromHeader='com', MailFrom='com'
X-Spam-charsets: plain='UTF-8', html='UTF-8'
X-Resolved-to: [REDACTED]
X-Delivered-to: [REDACTED]
X-Mail-from: lharris@slateberry.com
Received: from mx1 ([10.202.2.200])
  by compute1.internal (LMTPProxy); Wed, 18 Aug 2021 14:07:57 -0400
Received: from mx1.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 4B757660090
	for [REDACTED]; Wed, 18 Aug 2021 14:07:56 -0400 (EDT)
Received: from mx1.messagingengine.com (localhost [127.0.0.1])
    by mx1.messagingengine.com (Authentication Milter) with ESMTP
    id 0D0AF5283F2;
    Wed, 18 Aug 2021 14:07:56 -0400
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm3; t=
    1629310076; b=gFPfluIGzPJOqOtDKTBJkjynfAV/AXkLcJrS2JBSVd3XbWuLFQ
    25j4ESAwtrNQf51b38LLMLKBiwQoBu2Obc4VmIjSCLj9AStK8wSuU0/0zlxII5/D
    F0Gu/5h805VeNvyUGZtAfxe2685bLorvikd0Jn5rq05Nybk3/i8qFAMdcKk6WaH5
    ucs2NXwA2UOKJQQd5UvIx26XKw8fNwnq2IkaeVMhAZFOI0V8VQjvhqkJDlU79UtU
    3K4Xld78mxgyXS8UnMk/Rm2R+a+cc1Ku4ib1Jqhkx7BiqHGw6DxMCxd2RIkgRNVG
    z3XX+V53mjfLvzewEtXFc5HNOWOhBhPWkqUg==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=mime-version:from:date:message-id:subject
    :to:content-type; s=fm3; t=1629310076; bh=7BT1rSzovy3WL29CKNiZjg
    Ylgqmq7Uf0dpqnyQBnhJE=; b=FOABBynZeOI5W4VLDsCEKpnQkHb/6Pkd+UJDhb
    GzCq4WUfZ75rCjwiEOklpetOJBkgLzFsESLpWmXgwAkG4aK4vzlhjdMCL7YF0dsc
    zjudHwKDo3NxzUm/KHstZoAEEghlZzpdYlU/jgk2XLC/QuLw3hhbQ5fh0whVBQ+F
    XWTSLN8/H2BzwY/wiv0tnq0SGfbp2taTKu/43lkNdbddD7cCbUIcsv3KNC4tzjSI
    szsBzMkJJoAUmW5pyywbUEsNuvV558zCxaOUGZKUKSYz2dAvnZeLhfPnrtqnd6Ox
    vDQlGL531cOfUo9xetAkFhOTk8xm2NSaw50H7trhUIYTGCew==
ARC-Authentication-Results: i=1; mx1.messagingengine.com;
    arc=none (no signatures found);
    bimi=skipped (DMARC did not pass);
    dkim=pass (2048-bit rsa key sha256) header.d=slateberry.com
    header.i=@slateberry.com header.b=iGBLEcfm header.a=rsa-sha256
    header.s=google x-bits=2048;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=slateberry.com;
    iprev=pass smtp.remote-ip=209.85.166.43 (mail-io1-f43.google.com);
    spf=pass smtp.mailfrom=lharris@slateberry.com
    smtp.helo=mail-io1-f43.google.com;
    x-aligned-from=pass (Address match);
    x-csa=none;
    x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
    header.i=@1e100.net header.b=TljWsp0O;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-io1-f43.google.com
    policy.ptr=mail-io1-f43.google.com;
    x-return-mx=pass header.domain=slateberry.com policy.is_org=yes
    (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx2.googlemail.com,aspmx3.googlemail.com,aspmx.l.google.com);
    x-return-mx=pass smtp.domain=slateberry.com policy.is_org=yes
    (MX Records found: aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx2.googlemail.com,aspmx3.googlemail.com);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=30 state=0
Authentication-Results: mx1.messagingengine.com;
    arc=none (no signatures found);
    bimi=skipped (DMARC did not pass);
    dkim=pass (2048-bit rsa key sha256) header.d=slateberry.com
      header.i=@slateberry.com header.b=iGBLEcfm header.a=rsa-sha256
      header.s=google x-bits=2048;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=slateberry.com;
    iprev=pass smtp.remote-ip=209.85.166.43 (mail-io1-f43.google.com);
    spf=pass smtp.mailfrom=lharris@slateberry.com
      smtp.helo=mail-io1-f43.google.com;
    x-aligned-from=pass (Address match);
    x-csa=none;
    x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
      header.i=@1e100.net header.b=TljWsp0O;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-io1-f43.google.com
      policy.ptr=mail-io1-f43.google.com;
    x-return-mx=pass header.domain=slateberry.com policy.is_org=yes
      (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx2.googlemail.com,aspmx3.googlemail.com,aspmx.l.google.com);
    x-return-mx=pass smtp.domain=slateberry.com policy.is_org=yes
      (MX Records found: aspmx.l.google.com,alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx2.googlemail.com,aspmx3.googlemail.com);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=30 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddrleehgdduvddtucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhushhpvggtthfkmh
    hgffhomhgrihhnucdlfedtmdenucfjughrpegghfffkffuvfgtsegrtderredttdejnecu
    hfhrohhmpefnrghurhgvnhcujfgrrhhrihhsuceolhhhrghrrhhishesshhlrghtvggsvg
    hrrhihrdgtohhmqeenucggtffrrghtthgvrhhnpeevudevgeefgfejueefiedthfdutedt
    jeeihfdttddthfekfefgfffggeevveetgfenucffohhmrghinhepfihikhhiphgvughirg
    drohhrghdpmhgrthhthhgvfihgrhgrhigsohhstghhrdgtohhmpdifvghllhhptggsrdgt
    ohhmnecukfhppedvtdelrdekhedrudeiiedrgeefnecuvehluhhsthgvrhfuihiivgeptd
    enucfrrghrrghmpehinhgvthepvddtledrkeehrdduieeirdegfedphhgvlhhopehmrghi
    lhdqihhouddqfhegfedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepoehlhhgrrh
    hrihhssehslhgrthgvsggvrhhrhidrtghomheq
X-ME-VSScore: 30
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (slateberry.com: Sender is authorized to use 'lharris@slateberry.com' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx1.messagingengine.com;
    identity=mailfrom;
    envelope-from="lharris@slateberry.com";
    helo=mail-io1-f43.google.com;
    client-ip=209.85.166.43
Received: from mail-io1-f43.google.com (mail-io1-f43.google.com [209.85.166.43])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx1.messagingengine.com (Postfix) with ESMTPS
	for [REDACTED]; Wed, 18 Aug 2021 14:07:55 -0400 (EDT)
Received: by mail-io1-f43.google.com with SMTP id g9so4009067ioq.11
        for [REDACTED]; Wed, 18 Aug 2021 11:07:55 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=slateberry.com; s=google;
        h=mime-version:from:date:message-id:subject:to;
        bh=7BT1rSzovy3WL29CKNiZjgYlgqmq7Uf0dpqnyQBnhJE=;
        b=iGBLEcfmBzGwHs+7kRtohUgt7w97y+jji/nchen/tZLXVN1YY2zj3pmgyMRuUgDqGg
         7g7YzbpZqsxfnUPL3/7/wP+iKCITeBajk2XQGJ0aKp404igoG5ty73BoLZmXJZ1r7Uo2
         mzD9D8Xe/y/ZzMFarc3E2erA9c+MwvEA/Hpl98U0HMxLV3MYJyRdffZAPQ/C8WKfaAKy
         /DsNV/6bBPTN+zGEy8eJ7IYQSpqNgLXP7BQAoFpWRh9IKPLrepQqIFNYe/15i1wlF3aK
         JsHjF6+FdEH2Y9xQ9M9k0lUm3BgG6LhGTYk37Q7DO1AYxevQpWXyTDIGwfDzFCZXfU/r
         ejKQ==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:mime-version:from:date:message-id:subject:to;
        bh=7BT1rSzovy3WL29CKNiZjgYlgqmq7Uf0dpqnyQBnhJE=;
        b=TljWsp0OGIGVq0hzgbiqoM/V1ODnRKPZR46xZUTqMV46WPnGh1ZYnzlEQczYrAIk5z
         0XJrH0yfKy7aKq8Zf9Z9UT8CIBy7SuDp+8Q8Bys6hJvPW7dg3jFjeTBQi4Qf/vd0rXEn
         OCqvGI7MP/dZjgmv2kRAbd16tOnEW57/D+euZo9hTo4xOrR5EKBg/zPzE55+BgDvy4eg
         ucGeJZtz881BwnctREu5KSXz+l84NtUZlVDxth9yS5GxoPJ7UZZOfWw1y+/QZskU4JSD
         puChMlZ5T6bubigBtzarXrqSvHgDcUX9E3FfIv/iNzeF684EgpGE51+lH38fDHQhGlah
         +DSw==
X-Gm-Message-State: AOAM5300MxXuELWb8+nuSqkOl1uX+WQOL9sVKE5Z/oCvH0PgEGffix9w
	I0wx++c+G3Mt8uVCx/2Us2HNTgi7XMH7EiN5IiBaRjDnYPk=
X-Google-Smtp-Source: ABdhPJxUrCNb4veo8ZllgrVRwFcYHp/5eISe6ZbyAPXgZyTonwFHdVaBMvPnlsc2ygQO2r/dp4B1/u8zMoAtpZpKMiY=
X-Received: by 2002:a05:6602:2595:: with SMTP id p21mr7991275ioo.51.1629310074024;
 Wed, 18 Aug 2021 11:07:54 -0700 (PDT)
Received: from 776393159873 named unknown by gmailapi.google.com with
 HTTPREST; Wed, 18 Aug 2021 14:07:53 -0400
MIME-Version: 1.0
From: Lauren Harris <lharris@slateberry.com>
Date: Wed, 18 Aug 2021 14:07:53 -0400
Message-ID: <CA+B_sTBUfJNHs_D+1DKaMxatqCTswqc9znNxEL2Kj=SLqDAiOg@mail.gmail.com>
Subject: quick question
To: [REDACTED]
Content-Type: multipart/alternative; boundary="00000000000030ff9605c9d950a8"

--00000000000030ff9605c9d950a8
Content-Type: text/plain; charset="UTF-8"

I noticed you shared an article from En.Wikipedia.org when you talked
about PCB design software, here:
https://www.matthewgraybosch.com/tag/bsd/

I thought that the article from En.Wikipedia.org is pretty good, but
we recently published an article that goes much deeper and talks about
the ten best PCB design software tools in 2021.

Did you know that a PCB design tool helps users to collaborate on
various projects, access libraries of components created before and
know the accuracy of their circuit schematic design?

The article talks about the best PCB design software tools available
in the market today.

It also answers the following questions:

   - What is PCB design software and why do you need it?
   - What are the key features to look for when choosing PCB design tools?
   - What are other recommended PCB design software tools?
   - What is the evaluation criteria for PCB design software?

We quote 30 different sources in the article -- it's quite
authoritative.

Here's the article, if you're interested: [URL redacted]

Would you consider sharing our article with your readers by linking to
it?  Anyone who is looking for the best PCB design tool may find this
interesting.

Please let me know if you have any questions and thank you for your
time.

Thanks,
-Lauren

--
Lauren Harris, Editor
[address redacted]

BTW, if you didn't like getting this email, please reply with
something like "please don't email me anymore", and I'll make sure
that we don't.

If “Lauren Harris” is telling the truth, she was probably referring to my 2019 article, “I Want My BSD”. If so, that makes the rest of her post nonsensical. Why would I care about PCB design software just because I run a descendant of the Unix variant developed at UC Berkeley?

Furthermore, what kind of website is slateberry.com, anyway? It doesn’t use HTTPS. It’s just a blank page unless you use “view source”. Viewing the source shows a bit of JavaScript, but no actual content. I am not impressed.

General Observations

One thing I’ve noticed about the SEO spam I’ve been getting is that they all seem to come from GMail. So, not only is Google a monopolist, but their free email service is a possible spam vector. I hope the GMail team are proud of themselves.